PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g001480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 273aa    MW: 31261.7 Da    PI: 4.6783
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g001480.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2066119356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Csa19g001480.1  66 KKRRLTSEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 119
                     56789************************************************9 PP

2HD-ZIP_I/II134.73.2e-4365157193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl++eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ k++++Lr+e+++
  Csa19g001480.1  65 EKKRRLTSEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTS 157
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.11E-2053123IPR009057Homeodomain-like
PROSITE profilePS5007118.05861121IPR001356Homeobox domain
SMARTSM003896.1E-2064125IPR001356Homeobox domain
PfamPF000461.0E-1766119IPR001356Homeobox domain
CDDcd000868.73E-1966122No hitNo description
Gene3DG3DSA:1.10.10.603.2E-2267128IPR009057Homeodomain-like
PRINTSPR000314.0E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.0E-6101117IPR000047Helix-turn-helix motif
PfamPF021837.4E-17121162IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MESNSFYFDP SASQHGNMFF LGNLNPGGAR SMMMMNMEET SKRRPFFSSP EDLYDEEYYD  60
DQLPEKKRRL TSEQVHLLEK SFETENKLEP ERKTQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDLL KSTYDQLLSN YDSIVKDNDK LRSEVTSLTE KLLGKEEEAN NELPPGRQVP  180
EPNQLDPVYL NPAAVKTEDR LSSGSVGSAV LDEDAPQLLD SCDSYFPSLV PIHSQQDNNA  240
CDNDRVCFSD VFVPTTSPSH HHGESLGFWA WP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0581880.0AY058188.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankAY0989720.0AY098972.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankX588210.0X58821.1 A.thaliana homeobox gene Athb-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485418.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like isoform X2
SwissprotQ022831e-160HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLR0HRX80.0R0HRX8_9BRAS; Uncharacterized protein
STRINGAT3G01470.11e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88842738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-161homeobox 1